Structure of PDB 8j57 Chain 4

Receptor sequence
>8j574 (length=79) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
DPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFT
PFFITVGLVEAAYFINLAFMALFVFATPV
3D structure
PDB8j57 Structure of Mycobacterium tuberculosis ATP synthase
Chain4
Resolution2.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BQ1 4 E61 Y64 F65 E60 Y63 F64
Gene Ontology
Molecular Function
GO:0008289 lipid binding
GO:0015078 proton transmembrane transporter activity
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0006754 ATP biosynthetic process
GO:0015986 proton motive force-driven ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j57, PDBe:8j57, PDBj:8j57
PDBsum8j57
PubMed38961288
UniProtP9WPS1|ATPL_MYCTU ATP synthase subunit c (Gene Name=atpE)

[Back to BioLiP]