Structure of PDB 8iwh Chain 4

Receptor sequence

>8iwh4 (length=163) Species: 35128 (Thalassiosira pseudonana) [Search protein sequence]

ENEIGVLPPTGFFDPAGLSDGISQEKFDSYRLAELKHGRAAMLAVLGYVA
PETYRFGYDLIPGELSTNDIPNGVAAIKAIPFGGWAQMIAFVGCVETYGW
FTSPTGVLDLPDDILAKRQTAELQHGRLAMLAFLELIRHDSQNLAQPGFD
GLDNLITGLPFLY

3D structure

PDB

8iwh Structure of a diatom photosystem II supercomplex containing a member of Lhcx family and dimeric FCPII

Chain

Resolution

2.68 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	4	A82 T85 Y86 F193 L194	A50 T53 Y54 F161 L162
BS02	DD6	4	F45 L50 A76 G105 F165 L166	F13 L18 A44 G73 F133 L134
BS03	A86	4	M74 V77 L78 G138 A164 L168 I188 T189 G190	M42 V45 L46 G106 A132 L136 I156 T157 G158
BS04	CLA	4	P40 P41 A153 Q156	P8 P9 A121 Q124
BS05	CLA	4	F44 F45 L50 Y62 R63 E66 H69 R159 M162	F12 F13 L18 Y30 R31 E34 H37 R127 M130
BS06	CLA	4	A76 G79 R87 F88 Y90 T99 I102	A44 G47 R55 F56 Y58 T67 I70
BS07	CLA	4	I93 P113 G115 G116 Q119 A122 F123	I61 P81 G83 G84 Q87 A90 F91
BS08	CLA	4	L64 A65 H69 G125 E128	L32 A33 H37 G93 E96
BS09	CLA	4	R71 M74 L75 V139 R150 Q151 E154	R39 M42 L43 V107 R118 Q119 E122
BS10	CLA	4	A164 E167 R170	A132 E135 R138
BS11	CLA	4	F123 F133 S135 G138	F91 F101 S103 G106
BS12	CLA	4	R170 S173 Q174 F181	R138 S141 Q142 F149
BS13	CLA	4	T189 L191 P192 F193	T157 L159 P160 F161

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8iwh, PDBe:8iwh, PDBj:8iwh
PDBsum	8iwh
PubMed	37878698
UniProt	B8BVI1

[Back to BioLiP]