Structure of PDB 8hju Chain 4

Receptor sequence
>8hju4 (length=49) Species: 383372 (Roseiflexus castenholzii DSM 13941) [Search protein sequence]
NDLVPDQWKPLFNNAQWLVHDIVVKTIYGGLIIAVIAHVLCWAWTPWIR
3D structure
PDB8hju Carotenoid assembly regulates quinone diffusion and the Roseiflexus castenholzii reaction center-light harvesting complex architecture.
Chain4
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL 4 A40 H44 C47 A34 H38 C41
BS02 BCL 4 A40 H44 C47 W53 A34 H38 C41 W47
BS03 BCL 4 W14 F18 W23 H26 V30 I33 Y34 W8 F12 W17 H20 V24 I27 Y28
BS04 KGD 4 I39 L46 W50 I33 L40 W44
BS05 BCL 4 I28 K31 T32 G35 I22 K25 T26 G29
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hju, PDBe:8hju, PDBj:8hju
PDBsum8hju
PubMed37737710
UniProtA7NQE9

[Back to BioLiP]