Structure of PDB 7vy2 Chain 4

Receptor sequence
>7vy24 (length=43) Species: 39723 (Cereibacter sphaeroides f. sp. denitrificans) [Search protein sequence]
LGYTGLTDEQAQELHSVYMSGLWLFSAVAIVAHLAVYIWRPWF
3D structure
PDB7vy2 Asymmetric structure of the native Rhodobacter sphaeroides dimeric LH1-RC complex.
Chain4
Resolution2.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 SPO 4 A37 W44 A32 W39
BS02 BCL 4 F30 H38 F25 H33
BS03 SPO 4 L19 V22 Y23 G26 L14 V17 Y18 G21
BS04 BCL 4 F30 S31 A34 I35 H38 Y42 W47 F48 F25 S26 A29 I30 H33 Y37 W42 F43
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat May 10 01:39:38 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1471                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1472         else:
=> 1473             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1474     
   1475     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7vy2', asym_id = '4', title = 'Asymmetric structure of the native Rhodobacter sphaeroides dimeric LH1-RC complex.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7vy2', asym_id='4', title='Asymmetric structure of the native Rhodobacter sphaeroides dimeric LH1-RC complex.')
    840 
    841     if go:
=>  842         display_go(go,uniprot,pdbid,asym_id)
    843     return pubmed,uniprot
    844 
global display_go = <function display_go>, go = '0016020,0019684,0030077,0045156', uniprot = '', pdbid = '7vy2', asym_id = '4'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0019684,0030077,0045156', uniprot='', pdbid='7vy2', asym_id='4')
    481         '''.replace("$namespace_link",namespace_link
    482           ).replace("$namespace",namespace
=>  483           ).replace("$uniprot",u
    484         ))
    485         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>