Structure of PDB 7qh7 Chain 4

Receptor sequence

>7qh74 (length=37) Species: 9606 (Homo sapiens)

FKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQ

3D structure

• PDB: 7qh7 A late-stage assembly checkpoint of the human mitochondrial ribosome large subunit.
• Chain: 4
• Resolution: 2.89 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	4	F66 N68 T70 R75 K83 R84 R85 Y91 R97	F1 N3 T5 R10 K18 R19 R20 Y26 R32
BS02	ZN	4	C79 C92 H98	C14 C27 H33

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:7qh7, PDBe:7qh7, PDBj:7qh7
• PDBsum: 7qh7
• PubMed: 35177605
• UniProt: Q9P0J6|RM36_HUMAN Large ribosomal subunit protein bL36m (Gene Name=MRPL36)