Structure of PDB 7qgr Chain 4

Receptor sequence
>7qgr4 (length=150) Species: 562 (Escherichia coli) [Search protein sequence]
ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK
3D structure
PDB7qgr Ribosome collisions induce mRNA cleavage and ribosome rescue in bacteria.
Chain4
Resolution5.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4 V21 S22 K23 T24 V25 K26 R29 Y50 K52 K62 T90 F95 Q97 A99 G102 A107 G108 R112 K126 Y128 S130 T131 N132 N135 R138 V12 S13 K14 T15 V16 K17 R20 Y41 K43 K53 T81 F86 Q88 A90 G93 A98 G99 R103 K117 Y119 S121 T122 N123 N126 R129
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qgr, PDBe:7qgr, PDBj:7qgr
PDBsum7qgr
PubMed35264790
UniProtP0A7W1|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]