Structure of PDB 7o9k Chain 4

Receptor sequence
>7o9k4 (length=38) Species: 9606 (Homo sapiens) [Search protein sequence]
FKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM
3D structure
PDB7o9k Structural basis for late maturation steps of the human mitoribosomal large subunit.
Chain4
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4 F66 K67 N68 K69 T70 V71 L72 K73 R75 K77 K83 R84 R85 G86 W88 Y89 P96 R97 K99 R101 M103 F1 K2 N3 K4 T5 V6 L7 K8 R10 K12 K18 R19 R20 G21 W23 Y24 P31 R32 K34 R36 M38
BS02 ZN 4 C76 D78 C79 C92 C11 D13 C14 C27
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0016604 nuclear body
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o9k, PDBe:7o9k, PDBj:7o9k
PDBsum7o9k
PubMed34135318
UniProtQ9P0J6|RM36_HUMAN Large ribosomal subunit protein bL36m (Gene Name=MRPL36)

[Back to BioLiP]