Structure of PDB 7nhn Chain 4 |
>7nhn4 (length=79) Species: 169963 (Listeria monocytogenes EGD-e) [Search protein sequence] |
MKTGIHPEYRPVVFVDTSTDFKFLSGSTKSSSETIKWEDGNEYPLLRVEI SSDSHPFYTGKQKHATADGRVDRFNKKYG |
|
PDB | 7nhn Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens. |
Chain | 4 |
Resolution | 2.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
4 |
M1 K2 H6 |
M1 K2 H6 |
|
|
|
|