Structure of PDB 7msm Chain 4

Receptor sequence
>7msm4 (length=37) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
VKVNPSVKPICDKCRLIRRHGRVMVICSDPRHKQRQG
3D structure
PDB7msm Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Chain4
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4 V1 K2 P5 S6 V7 K8 L16 R18 R19 H20 P30 R31 K33 R35 Q36 V1 K2 P5 S6 V7 K8 L16 R18 R19 H20 P30 R31 K33 R35 Q36
BS02 ZN 4 C27 H32 C27 H32
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7msm, PDBe:7msm, PDBj:7msm
PDBsum7msm
PubMed35064151
UniProtP9WH89|RL36_MYCTU Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]