Structure of PDB 7jga Chain 4 |
>7jga4 (length=81) Species: 1772 (Mycolicibacterium smegmatis) [Search protein sequence] |
PNAIITAGALIGGGLIMGGGAIGAGIGDGIAGNALISGIARQPEAQGRLF TPFFITVGLVEAAYFINLAFMALFVFATPGL |
|
PDB | 7jga Structure of mycobacterial ATP synthase bound to the tuberculosis drug bedaquiline. |
Chain | 4 |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
BQ1 |
4 |
E65 A66 Y68 F69 |
E61 A62 Y64 F65 |
|
|
|
|