Structure of PDB 7ewk Chain 4

Receptor sequence

>7ewk4 (length=197) Species: 4513 (Hordeum vulgare) [Search protein sequence]

KGSWLPGLQSPAYLDGSLAGDNGFDPLALAEDPEDLRWFVQAELVNGRWA
MLGVAGMLIPEVLTKAGLLNAPEWYDAGKETYFASSSTLFVIEFILFHYV
EIRRWQDIKNPGSVNQDPIFKSYSLPPHECGYPGSVFNPLNFAPTLENKE
KELANGRLAMLAFLGFLVQHNVTGKGPFENLQQHLADPWHNTIIQTI

3D structure

PDB

7ewk Architecture of the chloroplast PSI-NDH supercomplex in Hordeum vulgare.

Chain

Resolution

3.88 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	4	R93 L97 Y177 P178 F182 P189 N193 K194 E197	R48 L52 Y132 P133 F137 P144 N148 K149 E152
BS02	CLA	4	K196 N200	K151 N155
BS03	CLA	4	L206 A207 G210 V213 Q214 H229 T237 I238	L161 A162 G165 V168 Q169 H184 T192 I193
BS04	CLA	4	L59 G65 D66 N67 F69 F84 V85 A87 E88 N91 R202 M205	L14 G20 D21 N22 F24 F39 V40 A42 E43 N46 R157 M160
BS05	CLA	4	F208 L209	F163 L164
BS06	CLA	4	H229 P233 W234 T237	H184 P188 W189 T192
BS07	CLA	4	W49 L50 P51 F69	W4 L5 P6 F24
BS08	CHL	4	Y120 G123 K124 L134 F135	Y75 G78 K79 L89 F90
BS09	CHL	4	W94 R148 D152 H173 F182	W49 R103 D107 H128 F137
BS10	CLA	4	W83 A87 V90 N91 F142 H143 E146 R149 W150	W38 A42 V45 N46 F97 H98 E101 R104 W105
BS11	CHL	4	Y127 F128 E138 F142	Y82 F83 E93 F97
BS12	CLA	4	H143 I147	H98 I102

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ewk, PDBe:7ewk, PDBj:7ewk
PDBsum	7ewk
PubMed	34879391
UniProt	Q9LKC7

[Back to BioLiP]