Structure of PDB 6zp4 Chain 4

Receptor sequence
>6zp44 (length=144) Species: 9606 (Homo sapiens) [Search protein sequence]
TYEELLNRVFNIMRRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKH
LLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCR
SPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLR
3D structure
PDB6zp4 Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
Chain4
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4 T214 K215 S249 I250 R296 T29 K30 S64 I65 R111
BS02 ZN 4 C302 C305 C117 C120
BS03 GTP 4 T283 S307 T98 S122
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0008135 translation factor activity, RNA binding
GO:0031369 translation initiation factor binding
GO:0046872 metal ion binding
Biological Process
GO:0001701 in utero embryonic development
GO:0001731 formation of translation preinitiation complex
GO:0002176 male germ cell proliferation
GO:0002183 cytoplasmic translational initiation
GO:0006412 translation
GO:0006413 translational initiation
GO:0008584 male gonad development
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005850 eukaryotic translation initiation factor 2 complex
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zp4, PDBe:6zp4, PDBj:6zp4
PDBsum6zp4
PubMed32680882
UniProtP20042|IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 (Gene Name=EIF2S2)

[Back to BioLiP]