Structure of PDB 6vmi Chain 4

Receptor sequence
>6vmi4 (length=38) Species: 9606 (Homo sapiens) [Search protein sequence]
FKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM
3D structure
PDB6vmi Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
Chain4
Resolution2.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4 K67 N68 K69 T70 V71 K73 R75 L81 K83 R84 R85 G86 W88 Y91 R97 K99 Q102 M103 K2 N3 K4 T5 V6 K8 R10 L16 K18 R19 R20 G21 W23 Y26 R32 K34 Q37 M38
BS02 ZN 4 C92 H95 H98 C27 H30 H33
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0016604 nuclear body
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vmi, PDBe:6vmi, PDBj:6vmi
PDBsum6vmi
PubMed32737313
UniProtQ9P0J6|RM36_HUMAN Large ribosomal subunit protein bL36m (Gene Name=MRPL36)

[Back to BioLiP]