Structure of PDB 6spd Chain 4

Receptor sequence
>6spd4 (length=44) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]
MKRTFQPSTLKRARVHGFRARMATKNGRQVLSRRRAKGRKRLTV
3D structure
PDB6spd Structure ofPseudomonas aeruginosaribosomes from an aminoglycoside-resistant clinical isolate.
Chain4
Resolution3.28 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4 M1 R3 T4 F5 Q6 T9 K11 R12 A13 R14 H16 F18 R19 M22 N26 R33 R34 R35 K37 G38 R39 K40 T43 M1 R3 T4 F5 Q6 T9 K11 R12 A13 R14 H16 F18 R19 M22 N26 R33 R34 R35 K37 G38 R39 K40 T43
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6spd, PDBe:6spd, PDBj:6spd
PDBsum6spd
PubMed31611393
UniProtA0A087L9L7

[Back to BioLiP]