Structure of PDB 6o90 Chain 4

Receptor sequence
>6o904 (length=44) Species: 1351 (Enterococcus faecalis) [Search protein sequence]
MKRTYQPNKRKRQKVHGFRKRMSTKNGRRVLASRRRKGRKVISA
3D structure
PDB6o90 Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
Chain4
Resolution3.49 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4 K2 R3 T4 Y5 P7 N8 K9 R10 K11 R12 Q13 K14 H16 F18 R19 R21 K25 N26 R29 R34 R35 R36 K37 G38 R39 K40 K2 R3 T4 Y5 P7 N8 K9 R10 K11 R12 Q13 K14 H16 F18 R19 R21 K25 N26 R29 R34 R35 R36 K37 G38 R39 K40
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6o90, PDBe:6o90, PDBj:6o90
PDBsum6o90
PubMed33004869
UniProtA0A1B4XSI4

[Back to BioLiP]