Structure of PDB 6nu2 Chain 4

Receptor sequence
>6nu24 (length=36) Species: 9606 (Homo sapiens) [Search protein sequence]
KNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQ
3D structure
PDB6nu2 Structural insights into unique features of the human mitochondrial ribosome recycling.
Chain4
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4 K67 N68 K69 K73 R75 K83 R84 G86 P96 R97 K99 R101 K1 N2 K3 K7 R9 K17 R18 G20 P30 R31 K33 R35
BS02 ZN 4 C76 D78 C79 C10 D12 C13
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nu2, PDBe:6nu2, PDBj:6nu2
PDBsum6nu2
PubMed30962385
UniProtQ9P0J6|RM36_HUMAN Large ribosomal subunit protein bL36m (Gene Name=MRPL36)

[Back to BioLiP]