Structure of PDB 6ha8 Chain 4

Receptor sequence
>6ha84 (length=37) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG
3D structure
PDB6ha8 Structural basis for antibiotic resistance mediated by theBacillus subtilisABCF ATPase VmlR.
Chain4
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4 M1 K2 R4 P5 S6 V7 K8 I10 K15 V16 R18 R19 V23 P30 K31 K33 K35 Q36 G37 M1 K2 R4 P5 S6 V7 K8 I10 K15 V16 R18 R19 V23 P30 K31 K33 K35 Q36 G37
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ha8, PDBe:6ha8, PDBj:6ha8
PDBsum6ha8
PubMed30126986
UniProtP20278|RL36_BACSU Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]