Structure of PDB 5uq7 Chain 4

Receptor sequence
>5uq74 (length=69) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFV
DTEGRVERFQRRYGDSYRK
3D structure
PDB5uq7 Alternative Mode of E-Site tRNA Binding in the Presence of a Downstream mRNA Stem Loop at the Entrance Channel.
Chain4
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4 M1 K2 I5 H6 M1 K2 I5 H6
BS02 ZN 4 C18 C36 C39 C18 C36 C39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5uq7, PDBe:5uq7, PDBj:5uq7
PDBsum5uq7
PubMed29456023
UniProtQ5SJE1|RL31_THET8 Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]