Structure of PDB 5mdx Chain 4

Receptor sequence

>5mdx4 (length=204) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

KKSWIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAEL
IHGRWAMAAVLGIFVGQAWSGVAWFEAGAQPDAIAPFSFGSLLGTQLLLM
GWVESKRWVDFFNPDSQSVEWATPWSKTAENFANYTGDQGYPGGRFFDPL
GLAGKNRDGVYEPDFEKLERLKLAEIKHSRLAMVAMLIFYFEAGQGKTPL
GALG

3D structure

PDB

5mdx Subunit and chlorophyll organization of the plant photosystem II supercomplex.

Chain

Resolution

5.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	4	W155 K159 V162 E173 W174 A175	W102 K106 V109 E120 W121 A122
BS02	CHL	4	S144 T148	S91 T95
BS03	CLA	4	L73 L77 G79 D80 F81 G82 F83 D84 Y98 E102 H105 R233 M236	L20 L24 G26 D27 F28 G29 F30 D31 Y45 E49 H52 R180 M183
BS04	CLA	4	W97 Y98 H105	W44 Y45 H52
BS05	CLA	4	A111 A112 G115 V118 G119 F128 A132 Q133	A58 A59 G62 V65 G66 F75 A79 Q80
BS06	CHL	4	W108 A136 Q149	W55 A83 Q96
BS07	CHL	4	R107 V156 R160 D163 N184 Q192 F200	R54 V103 R107 D110 N131 Q139 F147
BS08	CHL	4	W97 I104 H105 W108 M153 E157 R160 W161	W44 I51 H52 W55 M100 E104 R107 W108
BS09	CLA	4	R107 M110 Y188 Y194 P195 G196 D201 L205 L224 E228	R54 M57 Y135 Y141 P142 G143 D148 L152 L171 E175
BS10	CLA	4	R223 L224 H231 L234	R170 L171 H178 L181

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5mdx, PDBe:5mdx, PDBj:5mdx
PDBsum	5mdx
PubMed	28604725
UniProt	Q9LMQ2

[Back to BioLiP]