Structure of PDB 3j9m Chain 4

Receptor sequence
>3j9m4 (length=36) Species: 9606 (Homo sapiens) [Search protein sequence]
KNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQ
3D structure
PDB3j9m Ribosome. The structure of the human mitochondrial ribosome.
Chain4
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4 K67 N68 K69 T70 K73 K74 R75 R84 R85 G86 R87 W88 Y89 Y91 P96 R97 K99 R101 K1 N2 K3 T4 K7 K8 R9 R18 R19 G20 R21 W22 Y23 Y25 P30 R31 K33 R35
BS02 ZN 4 C76 C92 C10 C26
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0016604 nuclear body
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j9m, PDBe:3j9m, PDBj:3j9m
PDBsum3j9m
PubMed25838379
UniProtQ9P0J6|RM36_HUMAN Large ribosomal subunit protein bL36m (Gene Name=MRPL36)

[Back to BioLiP]