Structure of PDB 2wsc Chain 4

Receptor sequence

>2wsc4 (length=166) Species: 3888 (Pisum sativum) [Search protein sequence]

LAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAG
KEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAG
EVGYPGGIFNPLNFAPTLEAKEKEIANGRLMLAFLGFIIQHNVTGKGPFD
NLLQHISDPWHNTIVQ

3D structure

PDB

2wsc Structure Determination and Improved Model of Plant Photosystem I.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	4	W106 Q107 D108	W77 Q78 D79
BS02	CLA	4	I103 Q107	I74 Q78
BS03	CLA	4	G165 Q169	G136 Q140
BS04	CLA	4	R49 D118 T146	R20 D89 T117
BS05	CLA	4	K152 N156 M160	K123 N127 M131
BS06	CLA	4	E44 I154 R158	E15 I125 R129
BS07	CLA	4	L53 W75 Y76	L24 W46 Y47
BS08	CLA	4	F91 F95	F62 F66
BS09	CLA	4	R104 P119	R75 P90
BS10	CLA	4	A43 V46 N47 H99 E102 R105 W106	A14 V17 N18 H70 E73 R76 W77
BS11	CLA	4	W75 E94 F95	W46 E65 F66

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding
GO:0046872	metal ion binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2wsc, PDBe:2wsc, PDBj:2wsc
PDBsum	2wsc
PubMed	19923216
UniProt	Q9SQL2\|CB24_PEA Chlorophyll a-b binding protein P4, chloroplastic (Gene Name=lhcA-P4)

[Back to BioLiP]