Structure of PDB 1piv Chain 4 |
>1piv4 (length=62) Species: 12088 (Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B)) [Search protein sequence] |
GAQVSSQKVGAHENSSTINYTTINYYKDSASNAASKQDYSQDPSKFTEPL KDVLIKTAPALN |
|
PDB | 1piv Binding of the antiviral drug WIN51711 to the sabin strain of type 3 poliovirus: structural comparison with drug binding in rhinovirus 14. |
Chain | 4 |
Resolution | 2.9 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
4 |
A3 Q4 V5 |
A2 Q3 V4 |
|
|
|
|