Structure of PDB 1ar9 Chain 4 |
>1ar94 (length=60) Species: 12081 (Human poliovirus 1 Mahoney) [Search protein sequence] |
GAQVSSQKVGAHESTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKD VLIKTAPMLN |
|
PDB | 1ar9 Structural studies of poliovirus mutants that overcome receptor defects. |
Chain | 4 |
Resolution | 2.9 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
4 |
G2 A3 Q4 V5 S6 |
G1 A2 Q3 V4 S5 |
|
|
|
|