Structure of PDB 6ip6 Chain 3J

Receptor sequence
>6ip63J (length=122) Species: 9606 (Homo sapiens) [Search protein sequence]
VMDVNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVQASNCDEPM
YVKLVEALLAEHQINLIKVDDNKKLGEWVGLCKIDREGNPRKVVGCSCVV
VKDYGKESQAKDVIEEYFKCKK
3D structure
PDB6ip6 HCV IRES Captures an Actively Translating 80S Ribosome.
Chain3J
Resolution4.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3J D29 G30 L31 R33 G34 I35 R36 A39 Y61 R101 K102 S107 D19 G20 L21 R23 G24 I25 R26 A29 Y51 R91 K92 S97
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
GO:0090263 positive regulation of canonical Wnt signaling pathway
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005840 ribosome
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0043231 intracellular membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ip6, PDBe:6ip6, PDBj:6ip6
PDBsum6ip6
PubMed31080011
UniProtP25398|RS12_HUMAN Small ribosomal subunit protein eS12 (Gene Name=RPS12)

[Back to BioLiP]