Structure of PDB 6gsl Chain 3I

Receptor sequence

>6gsl3I (length=122) Species: 300852 (Thermus thermophilus HB8)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPK

3D structure

• PDB: 6gsl Tautomeric G•U pairs within the molecular ribosomal grip and fidelity of decoding in bacteria.
• Chain: 3I
• Resolution: 3.16 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	3I	P5 T6 N8 Q9 R12 R15 E16 K20 V24 G29 P31 F32 R33 K46 K47 N49 S50 A51 R53 K54 K57 E73 R86 G87 R89 K91 D92 P94 R97 R113 K114 K115 S116 R117 S118 K119 T122 K123 K124	P1 T2 N4 Q5 R8 R11 E12 K16 V20 G25 P27 F28 R29 K42 K43 N45 S46 A47 R49 K50 K53 E69 R82 G83 R85 K87 D88 P90 R93 R109 K110 K111 S112 R113 S114 K115 T118 K119 K120
BS02	rna	3I	K47 P48	K43 P44

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gsl, PDBe:6gsl, PDBj:6gsl
• PDBsum: 6gsl
• PubMed: 29931292
• UniProt: Q5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)