Structure of PDB 6lqv Chain 3E

Receptor sequence

>6lqv3E (length=431) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

YVLTETSAGYALLKASDKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNS
AANALEEANSIIEGKVSSQLEKLLEEIKKDKKSTLIVSETKLANAINKLG
LNFNVVSDAVTLDIYRAIKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKL
KFVDVMIIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYA
RIILTMGIRSKASETDLSEILPEEIEERVKTAAEVSMGTEITQTDLDNIN
ALAEQIVEFAAYREQLSNYLSARMKAIAPNLTQLVGELVGARLIAHSGSL
ISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLVGQATGKNK
GKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRLSQLEGRDL
RTTPKVVREAKKVEMTEARAYNADADTAKAA

3D structure

PDB

6lqv Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.

Chain

Resolution

4.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	3E	R298 H302 T316 Q318 I319 L320 E323 K324 F327 R328 K331 D335 T336 P337 K338 G340 K354 G357 K358 R361 V362 A365 K366 R397	R292 H296 T310 Q312 I313 L314 E317 K318 F321 R322 K325 D329 T330 P331 K332 G334 K348 G351 K352 R355 V356 A359 K360 R391
BS02	rna	3E	E415 A416 R425 A426 Y427 N428	E409 A410 R419 A420 Y421 N422

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0005515	protein binding
GO:0017069	snRNA binding
GO:0030515	snoRNA binding

	Biological Process
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000452	snoRNA guided rRNA 2'-O-methylation
GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000494	box C/D sno(s)RNA 3'-end processing
GO:0006364	rRNA processing
GO:0030490	maturation of SSU-rRNA
GO:0042254	ribosome biogenesis
GO:1902570	protein localization to nucleolus

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0030686	90S preribosome
GO:0031428	box C/D methylation guide snoRNP complex
GO:0032040	small-subunit processome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6lqv, PDBe:6lqv, PDBj:6lqv
PDBsum	6lqv
PubMed	32943522
UniProt	Q12499\|NOP58_YEAST Nucleolar protein 58 (Gene Name=NOP58)

[Back to BioLiP]