Structure of PDB 6gsj Chain 3E

Receptor sequence

>6gsj3E (length=207) Species: 300852 (Thermus thermophilus HB8)

RYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPS
DYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLD
NVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKS
RNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQL
VIEFYSR

3D structure

• PDB: 6gsj Tautomeric G•U pairs within the molecular ribosomal grip and fidelity of decoding in bacteria.
• Chain: 3E
• Resolution: 2.96 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	3E	R3 I5 P7 V8 C9 R10 R13 R14 K22 G23 R25 K30 R35 R36 Y38 P40 G41 Q42 H43 Q45 K46 R49 S52 Y54 R59 Q62 E72 R73 Q74 N77 K85 S113 R115 Q116 R118 Q119 R122 H123 H125 R132 V133 D134 L135 S137 K151 L155 L157 E205 S208 R209	R1 I3 P5 V6 C7 R8 R11 R12 K20 G21 R23 K28 R33 R34 Y36 P38 G39 Q40 H41 Q43 K44 R47 S50 Y52 R57 Q60 E70 R71 Q72 N75 K83 S111 R113 Q114 R116 Q117 R120 H121 H123 R130 V131 D132 L133 S135 K149 L153 L155 E203 S206 R207
BS02	MG	3E	A82 S83 K85	A80 S81 K83
BS03	SF4	3E	C9 C12 K18 Y20 K22 C26 C31	C7 C10 K16 Y18 K20 C24 C29

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gsj, PDBe:6gsj, PDBj:6gsj
• PDBsum: 6gsj
• PubMed: 29931292
• UniProt: P80373|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)