Structure of PDB 8uge Chain 3C

Receptor sequence

>8uge3C (length=379) Species: 9823 (Sus scrofa)

MTNIRKSHPLMKIINNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLF
LAMHYTSDTTTAFSSVTHICRDVNYGWVIRYLHANGASMFFICLFIHVGR
GLYYGSYMFLETWNIGVVLLFTVMATAFMGYVLPWGQMSFWGATVITNLL
SAIPYIGTDLVEWIWGGFSVDKATLTRFFAFHFILPFIITALAAVHLLFL
HETGSNNPTGISSDMDKIPFHPYYTIKDILGALFMMLILLILVLFSPDLL
GDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVASILI
LILMPMLHTSKQRSMMFRPLSQCLFWMLVADLITLTWIGGQPVEHPFIII
GQLASILYFLIILVLMPITSIIENNLLKW

3D structure

• PDB: 8uge High-resolution in situ structures of mammalian respiratory supercomplexes.
• Chain: 3C
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	3C	Q44 G48 L49 L51 R80 H83 G130 Y131 L133 P134 H182 F183 P186	Q44 G48 L49 L51 R80 H83 G130 Y131 L133 P134 H182 F183 P186
BS02	HEM	3C	W31 G34 L37 L94 H97 R100 S106 W113 G116 V117 H196 L197 L200 N206	W31 G34 L37 L94 H97 R100 S106 W113 G116 V117 H196 L197 L200 N206
BS03	U10	3C	F18 L21 S35 L197 H201 S205 F220 D228	F18 L21 S35 L197 H201 S205 F220 D228
BS04	U10	3C	M124 F128 I146 F274 L294	M124 F128 I146 F274 L294

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0022900 electron transport chain
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:8uge, PDBe:8uge, PDBj:8uge
• PDBsum: 8uge
• PubMed: 38811722
• UniProt: Q1HBG9