Structure of PDB 8cue Chain 3A |
>8cue3A (length=70) Species: 176299 (Agrobacterium fabrum str. C58) [Search protein sequence] |
GGTDPATMVNNICTFILGPFGQSLAVLGIVAIGISWMFGRASLGLVAGVV GGIVIMFGASFLGKTLTGGG |
|
PDB | 8cue Cryo-EM structure of the Agrobacterium tumefaciens T-pilus reveals the importance of positive charges in the lumen. |
Chain | 3A |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CPL |
3A |
L75 I85 F89 |
L24 I34 F38 |
|
|
|