Structure of PDB 6gsk Chain 39

Receptor sequence

>6gsk39 (length=204) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

EVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTK
TRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLP
KKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSE
SVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVF
QNRI

3D structure

PDB

6gsk Tautomeric G•U pairs within the molecular ribosomal grip and fidelity of decoding in bacteria.

Chain

Resolution

3.36 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	39	H31 L32 R38 Q40 K43 R44 R45 R46 T48 A49 S50 T51 K52 T53 R54 G55 V57 A58 Y59 S60 G61 R62 K63 Q67 K68 H69 G71 R72 A73 R74 H75 P81 I82 F83 V84 V89 F90 P92 R95 Y99 T100 P102 K103 K104 R106 K107 K135 T136 K137 R165 N169 L170 G180 N182 Y184	H29 L30 R36 Q38 K41 R42 R43 R44 T46 A47 S48 T49 K50 T51 R52 G53 V55 A56 Y57 S58 G59 R60 K61 Q65 K66 H67 G69 R70 A71 R72 H73 P79 I80 F81 V82 V87 F88 P90 R93 Y97 T98 P100 K101 K102 R104 K105 K133 T134 K135 R163 N167 L168 G178 N180 Y182
BS02	MG	39	R168 V173	R166 V171

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6gsk, PDBe:6gsk, PDBj:6gsk
PDBsum	6gsk
PubMed	29931292
UniProt	Q5SHN9\|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]