Structure of PDB 5el5 Chain 39

Receptor sequence

>5el539 (length=204) Species: 300852 (Thermus thermophilus HB8)

EVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTK
TRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLP
KKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSE
SVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVF
QNRI

3D structure

• PDB: 5el5 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
• Chain: 39
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	39	H31 L32 W34 E35 R38 Q40 K43 R44 R45 R46 T48 A49 S50 T51 K52 T53 R54 G55 V57 A58 Y59 S60 G61 R62 K63 Q67 K68 H69 G71 R72 A73 R74 H75 G76 P81 I82 F83 V84 V88 V89 F90 P92 R95 Y99 T100 P102 K103 K104 R106 K107 K108 K135 T136 R165 N169 P171 G180 N182 Y184 R205	H29 L30 W32 E33 R36 Q38 K41 R42 R43 R44 T46 A47 S48 T49 K50 T51 R52 G53 V55 A56 Y57 S58 G59 R60 K61 Q65 K66 H67 G69 R70 A71 R72 H73 G74 P79 I80 F81 V82 V86 V87 F88 P90 R93 Y97 T98 P100 K101 K102 R104 K105 K106 K133 T134 R163 N167 P169 G178 N180 Y182 R203
BS02	MG	39	R168 L170	R166 L168

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5el5, PDBe:5el5, PDBj:5el5
• PDBsum: 5el5
• PubMed: 26791911
• UniProt: Q5SHN9|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)