Structure of PDB 4wsm Chain 39

Receptor sequence

>4wsm39 (length=208) Species: 300852 (Thermus thermophilus HB8)

MKEVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTAS
TKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYT
LPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDG
SESVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWE
VFQNRIGG

3D structure

• PDB: 4wsm Structural insights into the translational infidelity mechanism.
• Chain: 39
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	39	H31 L32 W34 R38 Q40 K43 R44 R45 R46 T48 A49 S50 T51 T53 R54 G55 V57 A58 Y59 S60 R62 K63 W65 Q67 K68 H69 G71 R72 A73 R74 H75 G76 P81 I82 F83 V84 V88 V89 F90 P92 P94 R95 Y99 T100 P102 K103 K104 V105 R106 K107 G134 K135 R165 N169 L176 G180 N182 Y184	H31 L32 W34 R38 Q40 K43 R44 R45 R46 T48 A49 S50 T51 T53 R54 G55 V57 A58 Y59 S60 R62 K63 W65 Q67 K68 H69 G71 R72 A73 R74 H75 G76 P81 I82 F83 V84 V88 V89 F90 P92 P94 R95 Y99 T100 P102 K103 K104 V105 R106 K107 G134 K135 R165 N169 L176 G180 N182 Y184
BS02	MG	39	R168 V173	R168 V173

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wsm, PDBe:4wsm, PDBj:4wsm
• PDBsum: 4wsm
• PubMed: 26037619
• UniProt: Q5SHN9|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)