Structure of PDB 4wzo Chain 35

Receptor sequence

>4wzo35 (length=147) Species: 300852 (Thermus thermophilus HB8)

MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRR
FEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELL
VRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVL

3D structure

• PDB: 4wzo Structural insights into the translational infidelity mechanism.
• Chain: 35
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	35	S4 P8 N9 G11 A12 K14 R15 K17 R18 G20 R21 G22 G24 G28 K29 T30 A31 T32 R33 G34 H35 K36 G37 Q38 K39 S40 R41 S42 L45 K46 D47 P48 R50 F51 E52 G53 G54 R55 S56 M60 R61 L62 P63 K64 G66 M67 Q70 V71 P72 G73 E74 I75 R77 Q81 N84 R90 G104 L105 K107 K113 L115 G116 E117 S131 K132 S133	S4 P8 N9 G11 A12 K14 R15 K17 R18 G20 R21 G22 G24 G28 K29 T30 A31 T32 R33 G34 H35 K36 G37 Q38 K39 S40 R41 S42 L45 K46 D47 P48 R50 F51 E52 G53 G54 R55 S56 M60 R61 L62 P63 K64 G66 M67 Q70 V71 P72 G73 E74 I75 R77 Q81 N84 R90 G104 L105 K107 K113 L115 G116 E117 S131 K132 S133

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wzo, PDBe:4wzo, PDBj:4wzo
• PDBsum: 4wzo
• PubMed: 26037619
• UniProt: Q5SHQ7|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)