Structure of PDB 7vd5 Chain 32

Receptor sequence
>7vd532 (length=169) [Search protein sequence]
NELEIGATAPLGVYDPLGWLDGEPENFERRRAVERKHGRVAMAAVVGTIV
HNNHITFDGYLSPSANLKFSDIPTGVDGIRAIPTAGLLQILFFFALVELA
WMPASKYDGDYGVGWFGSNIEDPEEKARKLNVELNNGRAAMMGIMGNMVT
ECITGQTMYEQYAAGHFSP
3D structure
PDB7vd5 Structural basis for different types of hetero-tetrameric light-harvesting complexes in a diatom PSII-FCPII supercomplex
Chain32
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 A86 32 K66 V70 Y90 L91 I120 F124 K36 V40 Y60 L61 I90 F94
BS02 CLA 32 A130 W131 M132 A100 W101 M102
BS03 A86 32 F146 G147 F116 G117
BS04 CLA 32 G36 V43 Y44 D45 L47 W49 L50 F57 R60 R61 E64 H67 R168 M171 M172 G6 V13 Y14 D15 L17 W19 L20 F27 R30 R31 E34 H37 R138 M141 M142
BS05 CLA 32 R59 R60 H67 R29 R30 H37
BS06 CLA 32 A73 A74 G77 H81 T86 F87 F99 I102 G108 A43 A44 G47 H51 T56 F57 F69 I72 G78
BS07 KC1 32 L91 S92 S94 P113 A115 G116 Q119 I120 F123 L61 S62 S64 P83 A85 G86 Q89 I90 F93
BS08 CLA 32 I109 R110 I79 R80
BS09 KC1 32 R59 A62 V63 K66 H67 L121 A125 E128 L129 A134 S135 Y137 R29 A32 V33 K36 H37 L91 A95 E98 L99 A104 S105 Y107
BS10 CLA 32 R69 M72 G139 D140 Y141 V143 G144 W145 N149 I150 K156 K159 L160 V162 E163 N166 R39 M42 G109 D110 Y111 V113 G114 W115 N119 I120 K126 K129 L130 V132 E133 N136
BS11 CLA 32 P40 N161 V162 N165 N166 P10 N131 V132 N135 N136
BS12 KC1 32 V76 W145 R158 K159 V162 N166 V46 W115 R128 K129 V132 N136
BS13 CLA 32 M172 G173 G176 V179 T180 F197 P199 M142 G143 G146 V149 T150 F167 P169
BS14 A86 32 M72 G144 W145 F146 A169 A170 G173 N177 M188 Y192 M42 G114 W115 F116 A139 A140 G143 N147 M158 Y162
BS15 A86 32 Y44 P46 A74 G105 V106 I109 M171 I174 Y14 P16 A44 G75 V76 I79 M141 I144
BS16 A86 32 R168 M172 R138 M142
BS17 A86 32 M178 C182 M148 C152
BS18 A86 32 I79 N83 W145 M188 Y192 I49 N53 W115 M158 Y162
BS19 A86 32 Y192 A193 Y162 A163
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 30 01:30:54 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7vd5', asym_id = '32', title = 'Structural basis for different types of hetero-t...ing complexes in a diatom PSII-FCPII supercomplex'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7vd5', asym_id='32', title='Structural basis for different types of hetero-t...ing complexes in a diatom PSII-FCPII supercomplex')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009765,0016020', uniprot = '', pdbid = '7vd5', asym_id = '32'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009765,0016020', uniprot='', pdbid='7vd5', asym_id='32')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>