Structure of PDB 7vd5 Chain 31

Receptor sequence
>7vd531 (length=176) [Search protein sequence]
SEIELGVTEPLGVYDPLGWLESEPEAFERRRAVERKHGRVAMAAVVGTIV
HNNHIVFDGYLSPSNNLKFSDIPTGVDGIRAIPTAGLAQILAFFALVELA
WMPASKYDGDYGVGYFGTDIKDPEEKARKLNVELNNGRAAMMGIMGNMVA
EVLTGQTMYEQYASGHISPFGDGQGV
3D structure
PDB7vd5 Structural basis for different types of hetero-tetrameric light-harvesting complexes in a diatom PSII-FCPII supercomplex
Chain31
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA 31 Y44 W49 L50 F57 R60 R61 E64 H67 R168 M171 M172 Y14 W19 L20 F27 R30 R31 E34 H37 R138 M141 M142
BS02 KC1 31 R59 R60 V63 H67 M175 R29 R30 V33 H37 M145
BS03 CLA 31 A73 A74 G77 H81 V86 F87 I102 G108 A43 A44 G47 H51 V56 F57 I72 G78
BS04 KC1 31 L91 S92 P93 P113 G116 Q119 I120 L61 S62 P63 P83 G86 Q89 I90
BS05 CLA 31 I109 R110 M178 I79 R80 M148
BS06 KC1 31 R59 K66 H67 L121 F124 A125 E128 L129 A134 Y137 R29 K36 H37 L91 F94 A95 E98 L99 A104 Y107
BS07 CLA 31 R69 M72 G139 D140 Y141 V143 G144 Y145 D149 I150 K156 K159 L160 V162 E163 N166 R39 M42 G109 D110 Y111 V113 G114 Y115 D119 I120 K126 K129 L130 V132 E133 N136
BS08 KC1 31 V76 Y145 R158 K159 V162 N166 V46 Y115 R128 K129 V132 N136
BS09 CLA 31 M172 G176 V179 Q191 I197 S198 P199 D202 G203 Q204 G205 M142 G146 V149 Q161 I167 S168 P169 D172 G173 Q174 G175
BS10 A86 31 M72 V143 G144 F146 N166 A169 A170 G173 N177 Y192 M42 V113 G114 F116 N136 A139 A140 G143 N147 Y162
BS11 A86 31 Y44 P46 V70 A74 T78 G105 V106 I109 M171 I174 Y14 P16 V40 A44 T48 G75 V76 I79 M141 I144
BS12 A86 31 N165 R168 A169 M172 D202 Q204 N135 R138 A139 M142 D172 Q174
BS13 A86 31 R60 M175 V182 L183 R30 M145 V152 L153
BS14 A86 31 K66 V70 Y90 L91 I120 F124 K36 V40 Y60 L61 I90 F94
BS15 A86 31 Y192 A193 Y162 A163
BS16 CLA 31 E39 P40 N161 V162 N165 E9 P10 N131 V132 N135
BS17 A86 31 I79 N83 Y145 M188 Y192 I49 N53 Y115 M158 Y162
BS18 CLA 31 A130 W131 M132 A100 W101 M102
BS19 A86 31 F146 G147 F116 G117
Gene Ontology
Molecular Function
GO:0016168 chlorophyll binding
Biological Process
GO:0009416 response to light stimulus
GO:0009765 photosynthesis, light harvesting
GO:0009768 photosynthesis, light harvesting in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0009536 plastid
GO:0016020 membrane
GO:0030076 light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vd5, PDBe:7vd5, PDBj:7vd5
PDBsum7vd5
PubMed
UniProtA0A679BXP6

[Back to BioLiP]