Structure of PDB 9c4g Chain 3

Receptor sequence
>9c4g3 (length=37) Species: 1747 (Cutibacterium acnes) [Search protein sequence]
MKVQPSVKKICDKCKVIRRHGRVMVICDNPRHKQRQG
3D structure
PDB9c4g Mechanistic basis for the translation inhibition of Cutibacterium acnes by Clindamycin.
Chain3
Resolution2.53 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 M1 K2 V3 P5 S6 V7 K8 I10 R19 H20 V23 P30 R31 K33 R35 Q36 M1 K2 V3 P5 S6 V7 K8 I10 R19 H20 V23 P30 R31 K33 R35 Q36
External links