Structure of PDB 8y36 Chain 3

Receptor sequence

>8y363 (length=64) Species: 1280 (Staphylococcus aureus)

PKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVS
KSDMKRVKQLLAYK

3D structure

• PDB: 8y36 Synthetic macrolides overcoming MLS B K-resistant pathogens.
• Chain: 3
• Resolution: 2.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	3	P2 K3 M4 K5 T6 H7 R8 K12 R13 K15 T17 A18 S19 K23 R24 R26 A27 F28 S30 H31 L32 F33 A34 N35 T38 K39 Q40 K41 R42 R45 S51 K52 S53 D54 K56 R57 Q60 Y64	P1 K2 M3 K4 T5 H6 R7 K11 R12 K14 T16 A17 S18 K22 R23 R25 A26 F27 S29 H30 L31 F32 A33 N34 T37 K38 Q39 K40 R41 R44 S50 K51 S52 D53 K55 R56 Q59 Y63

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8y36, PDBe:8y36, PDBj:8y36
• PDBsum: 8y36
• PubMed: 38992047
• UniProt: P66277|RL35_STAAW Large ribosomal subunit protein bL35 (Gene Name=rpmI)