Structure of PDB 8wdu Chain 3

Receptor sequence
>8wdu3 (length=63) Species: 572477 (Allochromatium vinosum DSM 180) [Search protein sequence]
QLYKIWLAFDPRMALIGLGAFLFALALFIHYMLLRSPEFDWLLGPDYAPV
TLSAGMSALPAGR
3D structure
PDB8wdu High-resolution structure and biochemical properties of the LH1-RC photocomplex from the model purple sulfur bacterium, Allochromatium vinosum
Chain3
Resolution2.24 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 Z41 3 A27 F31 A24 F28
BS02 CRT 3 L30 H33 L27 H30
BS03 BCL 3 L18 G22 L25 F26 H33 W44 L15 G19 L22 F23 H30 W41
BS04 BCL 3 L25 L28 A29 I32 H33 F42 L22 L25 A26 I29 H30 F39
BS05 CRT 3 L18 L21 L28 F31 L15 L18 L25 F28
BS06 BCL 3 F12 F24 I32 F9 F21 I29
BS07 CRT 3 K7 I8 K4 I5
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wdu, PDBe:8wdu, PDBj:8wdu
PDBsum8wdu
PubMed38347078
UniProtD3RP67

[Back to BioLiP]