Structure of PDB 8w4p Chain 3

Receptor sequence

>8w4p3 (length=163) Species: 29205 (Stephanocyclus meneghinianus) [Search protein sequence]

ENEIGALAPTGFFDPAKLSDGISQEKFDQYRLAELKHGRAAMLAVLGYVA
PETYRFGYDLIPGELSTRDIPNGVAALNAIPFGGWVQMIAFVGTVEAYGW
FTSPTGVLDLPADILAKRQTSELQHGRLAMLAFLELIRHDSQNLAQPGFD
GYDNLITGLPFLY

3D structure

PDB

8w4p Structural insights into photosystem II supercomplex and trimeric FCP antennae of a centric diatom Cyclotella meneghiniana.

Chain

Resolution

3.48 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	A86	3	M74 S135 A164 L168 I188 T189 G190	M42 S103 A132 L136 I156 T157 G158
BS02	DD6	3	D46 P47 L50 A76 Y80 G105 M162 F165	D14 P15 L18 A44 Y48 G73 M130 F133
BS03	CLA	3	A40 S153 Q156 H157	A8 S121 Q124 H125
BS04	CLA	3	G37 F45 Y62 R63 E66 H69 R159	G5 F13 Y30 R31 E34 H37 R127
BS05	CLA	3	L75 A76 G79 P83 R87 F88	L43 A44 G47 P51 R55 F56
BS06	CLA	3	A65 K68 H69	A33 K36 H37
BS07	CLA	3	R71 M74 L75 R150 Q151 E154 H157	R39 M42 L43 R118 Q119 E122 H125
BS08	CLA	3	E167 R170	E135 R138
BS09	CLA	3	R170 S173 Q174	R138 S141 Q142
BS10	CLA	3	G190 L191 P192	G158 L159 P160
BS11	CLA	3	V81 A82 T85 Y86 F193 L194	V49 A50 T53 Y54 F161 L162

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009536	plastid
GO:0016020	membrane
GO:0030076	light-harvesting complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8w4p, PDBe:8w4p, PDBj:8w4p
PDBsum	8w4p
PubMed	38071196
UniProt	B8BVI1

[Back to BioLiP]