Structure of PDB 8uua Chain 3 |
>8uua3 (length=59) Species: 1642 (Listeria innocua) [Search protein sequence] |
MKTGIHPEYRPVVFVDTSTDFKFLSGSTKSSSETIKWEDGNEYPLLRVEI SSDSHPFYT |
|
PDB | 8uua Mechanistic insights into the alternative ribosome recycling by HflXr. |
Chain | 3 |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
3 |
M1 K2 |
M1 K2 |
|
|
|
|