Structure of PDB 8qu1 Chain 3

Receptor sequence
>8qu13 (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
LTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKAGYKKKLWKKTPARKKR
LREFVFCNKTQSKLLDKMTTSFWKRRNWYVDDPYQKYHDRTNLKV
3D structure
PDB8qu1 GTPBP8 plays a role in mitoribosome formation in human mitochondria.
Chain3
Resolution2.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 3 F97 S98 R100 K103 R104 K105 T106 K108 R113 H118 R124 K126 A127 R140 K142 R143 K152 Q154 K156 K160 F165 W166 R168 R169 D182 V188 F4 S5 R7 K10 R11 K12 T13 K15 R20 H25 R31 K33 A34 R47 K49 R50 K59 Q61 K63 K67 F72 W73 R75 R76 D89 V95
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8qu1, PDBe:8qu1, PDBj:8qu1
PDBsum8qu1
PubMed38969660
UniProtQ9NZE8|RM35_HUMAN Large ribosomal subunit protein bL35m (Gene Name=MRPL35)

[Back to BioLiP]