Structure of PDB 8qbt Chain 3

Receptor sequence

>8qbt3 (length=42) Species: 679895 (Escherichia coli BW25113) [Search protein sequence]

DVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVK

3D structure

PDB

8qbt Novel arrest peptides induce ribosome stalling by short circuiting the ribosomal peptidyltransferase activity

Chain

Resolution

2.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	3	F37 Y38 E39 R45 K49	F25 Y26 E27 R33 K37

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8qbt, PDBe:8qbt, PDBj:8qbt
PDBsum	8qbt
PubMed	38503735
UniProt	P68679\|RS21_ECOLI Small ribosomal subunit protein bS21 (Gene Name=rpsU)