Structure of PDB 8k5o Chain 3

Receptor sequence
>8k5o3 (length=51) Species: 1052 (Halorhodospira halochloris) [Search protein sequence]
MWRIWKVFDPRRILIATALWLIIISLTIHVILMTTERFNWLQGAPAAEYY
S
3D structure
PDB8k5o Structural insights into the unusual core photocomplex from a triply extremophilic purple bacterium, Halorhodospira halochloris.
Chain3
Resolution2.42 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 A1LZM 3 L21 I24 S25 I28 H29 L32 F38 L21 I24 S25 I28 H29 L32 F38
BS02 LYC 3 L14 T17 W20 L21 I24 I31 L14 T17 W20 L21 I24 I31
BS03 A1LZM 3 A18 L21 I22 S25 H29 W40 A18 L21 I22 S25 H29 W40
BS04 A1LZM 3 I13 W20 I28 I13 W20 I28
BS05 A1LZM 3 M1 I4 M1 I4
BS06 A1LZM 3 S25 L26 H29 S25 L26 H29
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0046872 metal ion binding
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8k5o, PDBe:8k5o, PDBj:8k5o
PDBsum8k5o
PubMed38411333
UniProtA0A120MZP7

[Back to BioLiP]