Structure of PDB 8g0e Chain 3 |
>8g0e3 (length=81) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] |
PNAIITAGALIGGGLIMGGGAIGAGIGDGIAGNALISGIARQPEAQGRLF TPFFITVGLVEAAYFINLAFMALFVFATPGL |
|
PDB | 8g0e Mechanism of mycobacterial ATP synthase inhibition by squaramides and second generation diarylquinolines. |
Chain | 3 |
Resolution | 2.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
YGR |
3 |
E65 A66 F69 |
E61 A62 F65 |
|
|
|
|