Structure of PDB 8fzg Chain 3

Receptor sequence

>8fzg3 (length=60) Species: 562 (Escherichia coli)

MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQGR
VDRFNKRFNI

3D structure

• PDB: 8fzg The ribosome termination complex remodels release factor RF3 and ejects GDP
• Chain: 3
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	3	R59 R63	R53 R57
BS02	rna	3	M1 K2 H6	M1 K2 H6
BS03	ZN	3	C16 C18 C37 C40	C16 C18 C37 C40

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006413 translational initiation
• GO:1904689 negative regulation of cytoplasmic translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fzg, PDBe:8fzg, PDBj:8fzg
• PDBsum: 8fzg
• PubMed: 39030416
• UniProt: P0A7M9|RL31_ECOLI Large ribosomal subunit protein bL31 (Gene Name=rpmE)