Structure of PDB 8cen Chain 3

Receptor sequence
>8cen3 (length=131) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
NKDMCPICKTDRYLSPDVKFLVNPECYHRICESCVDRIFSLGPAQCPYKG
CDKILRKNKFKTQIFDDVEVEKEVDIRKRVFNVFNKTIDDFNGDLVEYNK
YLEEVEDIIYKLDHGIDVAKTEEKLRTYEEL
3D structure
PDB8cen Yeast PIC-Mediator structure with RNA polymerase II C-terminal domain.
Chain3
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN 3 C13 C16 C39 C42 C5 C8 C31 C34
BS02 ZN 3 C34 H36 C54 C59 C26 H28 C46 C51
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 30 19:50:38 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8cen', asym_id = '3', title = 'Yeast PIC-Mediator structure with RNA polymerase II C-terminal domain.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8cen', asym_id='3', title='Yeast PIC-Mediator structure with RNA polymerase II C-terminal domain.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0005675,0006289,0045737,0061575', uniprot = '', pdbid = '8cen', asym_id = '3'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005675,0006289,0045737,0061575', uniprot='', pdbid='8cen', asym_id='3')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>