Structure of PDB 8a57 Chain 3

Receptor sequence
>8a573 (length=56) Species: 169963 (Listeria monocytogenes EGD-e) [Search protein sequence]
KLEITLKRSLIGRPQPQRKTVQALGLGKTNSVVVKEDNPAIRGMITKVSH
LVDVKE
3D structure
PDB8a57 Structural basis for HflXr-mediated antibiotic resistance in Listeria monocytogenes.
Chain3
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 R10 S11 I13 G14 R15 K21 T22 A25 K30 T31 N32 K37 N40 P41 A42 G45 M46 R8 S9 I11 G12 R13 K19 T20 A23 K28 T29 N30 K35 N38 P39 A40 G43 M44
BS02 rna 3 R15 Q19 H52 R13 Q17 H50
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a57, PDBe:8a57, PDBj:8a57
PDBsum8a57
PubMed36300626
UniProtQ927M5|RL30_LISMO Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]