Structure of PDB 7vrj Chain 3

Receptor sequence

>7vrj3 (length=65) Species: 553982 (Allochromatium tepidum)

PQQLYKIWLAFDPRMALIGLGAFLFALALFIHYMLLSSPGFDWLLGPDHA
PVALSAGMSALPAGR

3D structure

• PDB: 7vrj A Ca 2+ -binding motif underlies the unusual properties of certain photosynthetic bacterial core light-harvesting complexes.
• Chain: 3
• Resolution: 2.81 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CRT	3	L30 H33	L29 H32
BS02	BCL	3	L25 F26 A29 H33 W44	L24 F25 A28 H32 W43
BS03	BCL	3	L25 L28 A29 I32 H33	L24 L27 A28 I31 H32
BS04	CRT	3	L18 L21 F31 M35	L17 L20 F30 M34

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 07:28:47 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7vrj', asym_id = '3', title = 'A Ca 2+ -binding motif underlies the unusual pro...thetic bacterial core light-harvesting complexes.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7vrj', asym_id='3', title='A Ca 2+ -binding motif underlies the unusual pro...thetic bacterial core light-harvesting complexes.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016020,0019684,0030077,0045156', uniprot = '', pdbid = '7vrj', asym_id = '3'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0019684,0030077,0045156', uniprot='', pdbid='7vrj', asym_id='3')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>