Structure of PDB 7unw Chain 3

Receptor sequence
>7unw3 (length=47) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
MKADIHPTYEAIEATCSCGNVIKTRSTLCKPIHLDVCSECHPFYTGK
3D structure
PDB7unw Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
Chain3
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 M1 K2 H6 M1 K2 H6
BS02 ZN 3 C16 C18 C37 C16 C18 C37
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7unw, PDBe:7unw, PDBj:7unw
PDBsum7unw
PubMed
UniProtQ9HUD0|RL31_PSEAE Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]