Structure of PDB 7ryh Chain 3

Receptor sequence
>7ryh3 (length=38) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
MKVQASVKKICGSCKVIRRNGVIRVICSAEPRHKQRQG
3D structure
PDB7ryh An Analysis of the Novel Fluorocycline TP-6076 Bound to Both the Ribosome and Multidrug Efflux Pump AdeJ from Acinetobacter baumannii.
Chain3
Resolution2.43 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 M1 K2 A5 S6 K15 R19 N20 R24 R32 K34 R36 Q37 M1 K2 A5 S6 K15 R19 N20 R24 R32 K34 R36 Q37
BS02 ZN 3 C27 H33 C27 H33
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ryh, PDBe:7ryh, PDBj:7ryh
PDBsum7ryh
PubMed35100868
UniProtB7IA18|RL36_ACIB5 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]